Proteintech, 26084-1-AP, RNF217 Polyclonal antibody

Size: 20ul / 150ul The RNF217 (26084-1-AP) by Proteintech is a Polyclonal antibody targeting RNF217 in IHC, IF/ICC, ELISA applications with reactivity to human samples 26084-1-AP targets RNF217 in IHC, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive IHC detected in: human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information E3 ubiquitin-protein ligase RNF217, also known as IBR domain-containing protein 1 (IBRDC1), as a transmembrane (TM) domain-containing RBR-type E3 ubiquitin-protein ligase, belongs to a highly conserved member of the RING finger family. RNF217 mediates the degradation of the iron exporter ferroportin/SLC40A1 and thus regulates iron homeostasis(Uniprot, PMID: 33895792). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag22022 Product name: Recombinant human RNF217 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 1-275 aa of BC026087 Sequence: MKVQLGQVEIKCPITECFEFLEETTVVYNLTHEDSIKYKYFLELGRIDSSTKPCPQCKHFTTFKKKGHIPTPSRSESKYKIQCPTCQFVWCFKCHSPWHEGVNCKEYKKGDKLLRHWASEIEHGQRNAQKCPKCKIHIQRTEGCDHMTCSQCNTNFCYRCGERYRQLRFFGDHTSNLSIFGCKYRYLPERPHLRRLVRGSVCAGKLFIAPLIMVLGLALGAIAVVIVEEIKTYWNLISGRTRNQTQHLAPQPVLLSDMLYCLKQVFICISYLLPL Predict reactive species Full Name: ring finger protein 217 Calculated Molecular Weight: 275 aa, 32 kDa Observed Molecular Weight: 59, 32 kDa GenBank Accession Number: BC026087 Gene Symbol: RNF217 Gene ID (NCBI): 154214 RRID: AB_3085839 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8TC41 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.