Proteintech, 26090-1-AP, FAM35A Polyclonal antibody

Size: 20ul / 150ul The FAM35A (26090-1-AP) by Proteintech is a Polyclonal antibody targeting FAM35A in WB, ELISA applications with reactivity to human samples 26090-1-AP targets FAM35A in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HCT 116 cells, HepG2 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag23416 Product name: Recombinant human FAM35A protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-350 aa of BC051863 Sequence: MSGGSQVHIFWGAPIAPLKITVSEDTASLMSVADPWKKIQLLYSQHSLYLKDEKQHKNLENYKVPESIGSPDLSGHFLANCMNRHVHVKDDFVRSVSETQNIESQKIHSSRLSDITSSNMQICGFKSTVPHFTEEEKYQKLLSENKIRDEQPKHQPDICGKNFNTNLFQLGHKCAAVLDLVCSTEKINIGPEVVQRECVPTEYHEIQNQCLGLFSSNAVDKSRSEAAVRKVSDLKISTDTEFLSIITSSQVAFLAQKKDKRRSPVNKGNVNMETEPKASYGEIRIPEENSIQLDGFTEAYESGQNQAYSLELFSPVCPKTENSRIHINSDKGLEEHTGSQELFSSEDELP Predict reactive species Full Name: family with sequence similarity 35, member A Observed Molecular Weight: 80-93 kDa GenBank Accession Number: BC051863 Gene Symbol: FAM35A Gene ID (NCBI): 54537 RRID: AB_3085840 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q86V20 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.