Iright
BRAND / VENDOR: Proteintech

Proteintech, 26118-1-AP, DMRTB1 Polyclonal antibody

CATALOG NUMBER: 26118-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The DMRTB1 (26118-1-AP) by Proteintech is a Polyclonal antibody targeting DMRTB1 in WB, ELISA applications with reactivity to human samples 26118-1-AP targets DMRTB1 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: human testis tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information DMRTB1, also named as Doublesex- and mab-3-related transcription factor B1, is a 342 amino acid protein, which contains 1 DM DNA-binding domain and belongs to the DMRT family. DMRTB1 is expressed in testis. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag23639 Product name: Recombinant human DMRTB1 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 1-189 aa of BC029566 Sequence: MPSLAGPPFGAEAAGSGYPGPLDLRRPMRTVPGPLFTDFVRPLNINPDRALGPEYPGGSSMHPYCPFPLGYLDAPPGVPLQQGFRHVSRSQYQGGGLVSEPGGDFQPSYYLPPPPPPLPPLPPLPPQPQFLPPGYLSALHFLPPPPPPPPPSSFSLTVLFDTDKENTDDQDAEVLSGEPSQPSSQEQSD Predict reactive species Full Name: DMRT-like family B with proline-rich C-terminal, 1 Observed Molecular Weight: 40-45 kDa GenBank Accession Number: BC029566 Gene Symbol: DMRTB1 Gene ID (NCBI): 63948 RRID: AB_2880388 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96MA1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924