Proteintech, 26126-1-AP, ECHDC2 Polyclonal antibody

Size: 20ul / 150ul The ECHDC2 (26126-1-AP) by Proteintech is a Polyclonal antibody targeting ECHDC2 in WB, ELISA applications with reactivity to human, rat samples 26126-1-AP targets ECHDC2 in WB, ELISA applications and shows reactivity with human, rat samples. Tested Applications Positive WB detected in: rat kidney tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Specification Tested Reactivity: human, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag23510 Product name: Recombinant human ECHDC2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 37-90 aa of BC044574 Sequence: GPDQGITEILMNRPSARNALGNVFVSELLETLAQLREDRQVRVLLFRSGVKGVF Predict reactive species Full Name: enoyl Coenzyme A hydratase domain containing 2 Observed Molecular Weight: 29-31 kDa GenBank Accession Number: BC044574 Gene Symbol: ECHDC2 Gene ID (NCBI): 55268 RRID: AB_3085842 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q86YB7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.