Product Description
Size: 20ul / 150ul
The ECHDC2 (26126-1-AP) by Proteintech is a Polyclonal antibody targeting ECHDC2 in WB, ELISA applications with reactivity to human, rat samples
26126-1-AP targets ECHDC2 in WB, ELISA applications and shows reactivity with human, rat samples.
Tested Applications
Positive WB detected in: rat kidney tissue
Recommended dilution
Western Blot (WB): WB : 1:1000-1:6000
Specification
Tested Reactivity: human, rat
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag23510 Product name: Recombinant human ECHDC2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 37-90 aa of BC044574 Sequence: GPDQGITEILMNRPSARNALGNVFVSELLETLAQLREDRQVRVLLFRSGVKGVF Predict reactive species
Full Name: enoyl Coenzyme A hydratase domain containing 2
Observed Molecular Weight: 29-31 kDa
GenBank Accession Number: BC044574
Gene Symbol: ECHDC2
Gene ID (NCBI): 55268
RRID: AB_3085842
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: Q86YB7
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924