Proteintech, 26131-1-AP, MPIG6B Polyclonal antibody

Size: 20ul / 150ul The MPIG6B (26131-1-AP) by Proteintech is a Polyclonal antibody targeting MPIG6B in WB, ELISA applications with reactivity to human samples 26131-1-AP targets MPIG6B in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: human peripheral blood platelets Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information C6orf25, also called G6B, is an inhibitory receptor expressed on the surface of platelets,and it acts as a critical regulator of hematopoietic lineage differentiation, megakaryocyte function and platelet production (PMID: 17311996; 12665801; 27743390). C6orf25 has seven isoforms. Isoform B is the only isoform to contain both a transmembrane region and 2 immunoreceptor tyrosine-based inhibitor motifs (ITIMs) and, thus, the only one which probably has a role of inhibitory receptor. Isoform A may be the activating counterpart of isoform B (PMID: 11544253). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag23442 Product name: Recombinant human C6orf25 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-131 aa of BC113719 Sequence: MAVFLQLLPLLLSRAQGNPGASLDGRPGDRVNLSCGGVSHPIRWVWAPSFPACKGLSKGRRPILWASSSGTPTVPPLQPFVGRLRSLDSGIRRLELLLSAGDSGTFFCKGRHEDESRTVLHVLGDRTYCKA Predict reactive species Full Name: chromosome 6 open reading frame 25 Observed Molecular Weight: 24-29 kDa GenBank Accession Number: BC113719 Gene Symbol: C6orf25 Gene ID (NCBI): 80739 RRID: AB_3669524 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O95866 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.