Proteintech, 26132-1-AP, RGS11 Polyclonal antibody

Size: 20ul / 150ul The RGS11 (26132-1-AP) by Proteintech is a Polyclonal antibody targeting RGS11 in WB, IHC, ELISA applications with reactivity to human, rat, mouse samples 26132-1-AP targets RGS11 in WB, IHC, ELISA applications and shows reactivity with human, rat, mouse samples. Tested Applications Positive WB detected in: HL-60 cells, rat brain tissue Positive IHC detected in: human lung cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Specification Tested Reactivity: human, rat, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag23562 Product name: Recombinant human RGS11 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 22-102 aa of BC153019 Sequence: MERVVVSMQDPDQGVKMRSQRLLVTVIPHAVTGSDVVQWLAQKFCVSEEEALHLGAVLVQHGYIYPLRDPRSLMLRPDETP Predict reactive species Full Name: regulator of G-protein signaling 11 Observed Molecular Weight: 53 kDa GenBank Accession Number: BC153019 Gene Symbol: RGS11 Gene ID (NCBI): 8786 RRID: AB_2880394 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O94810 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.