Proteintech, 26137-1-AP, C13orf33 Polyclonal antibody

Size: 20ul / 150ul The C13orf33 (26137-1-AP) by Proteintech is a Polyclonal antibody targeting C13orf33 in WB, IP, ELISA applications with reactivity to human samples 26137-1-AP targets C13orf33 in WB, IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HepG2 cells Positive IP detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag23516 Product name: Recombinant human C13orf33 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-303 aa of BC101626 Sequence: MAGAACEPVARPSLTSISSGELRSLWTCDCELALLPLAQLLRLQPGAFQLSGDQLVVAGPGEPAAARGGFNVFGDGLVRLDGQLYRLSSYIKRYVELTNYCDYKDYRETILSKPMLFFINVQTKKDTSKERTYAFLVNTRHPKIRRQIEQGMDMVISSVIGESYRLQFDFQEAVKNFFPPGNEVVNGENLSFAYEFKADALFDFFYWFGLSNSVVKVNGKVLNLSSTSPEKKETIKLFLEKMSEPLIRRSSFSDRKFSVTSRGSIDDVFNCNLSPRSSLTEPLLAELPFPSVLESEETPNQFI Predict reactive species Full Name: chromosome 13 open reading frame 33 Observed Molecular Weight: 34-45 kDa GenBank Accession Number: BC101626 Gene Symbol: C13orf33 Gene ID (NCBI): 84935 RRID: AB_2880396 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q5VYS4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.