Iright
BRAND / VENDOR: Proteintech

Proteintech, 26161-1-AP, MCP-1/CCL2 Polyclonal antibody

CATALOG NUMBER: 26161-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The MCP-1/CCL2 (26161-1-AP) by Proteintech is a Polyclonal antibody targeting MCP-1/CCL2 in WB, ELISA applications with reactivity to mouse samples 26161-1-AP targets MCP-1/CCL2 in WB, IHC, IF, ELISA applications and shows reactivity with mouse samples. Tested Applications Positive WB detected in: LPS and Brefeldin A treated RAW 264.7 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information Monocyte chemoattractant protein-1 (MCP-1/CCL2) is one of the key chemokines that regulate migration and infiltration of monocytes/macrophages. Both CCL2 and its receptor CCR2 have been demonstrated to be induced and involved in various diseases. Migration of monocytes from the blood stream across the vascular endothelium is required for routine immunological surveillance of tissues, as well as in response to inflammation. Specification Tested Reactivity: mouse Cited Reactivity: mouse, rat, bovine Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag24085 Product name: Recombinant mouse Mcp1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 24-148 aa of NM-011333 Sequence: QPDAVNAPLTCCYSFTSKMIPMSRLESYKRITSSRCPKEAVVFVTKLKREVCADPKKEWVQTYIKNLDRNQMRSEPTTLFKTASALRSSAPLNVKLTRKSEANASTTFSTTTSSTSVGVTSVTVN Predict reactive species Full Name: chemokine (C-C motif) ligand 2 Observed Molecular Weight: 16-20 kDa GenBank Accession Number: NM-011333 Gene Symbol: MCP-1/CCL2 Gene ID (NCBI): 20296 RRID: AB_2918100 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P10148 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924