Iright
BRAND / VENDOR: Proteintech

Proteintech, 26182-1-AP, SLC13A3 Polyclonal antibody

CATALOG NUMBER: 26182-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The SLC13A3 (26182-1-AP) by Proteintech is a Polyclonal antibody targeting SLC13A3 in WB, IHC, ELISA applications with reactivity to human, mouse samples 26182-1-AP targets SLC13A3 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse kidney tissue, HEK-293 cells Positive IHC detected in: mouse kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information SLC13A3, also named NADC3 and SDCT2, belongs to the SLC13A/DASS transporter (TC 2.A.47) family and NADC subfamily. SLC13A3 encodes the plasma membrane Na+ /Dicarboxylate Cotransporter 3 (NaDC3), which imports inside the cell four to six carbon dicarboxylates as well as N-acetylaspartate (NAA). SLC13A3 is mainly expressed in kidney, but also in brain, liver, placenta and eye (PMID: 30635937). This antibody detected the 55-60 kDa band in SDS-PAGE. However, the 55 kDa (nonglycosylated) and 85 kDa (glycosylated) bands have been reported in the article (PMID: 27053689). Specification Tested Reactivity: human, mouse Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag24183 Product name: Recombinant human SLC13A3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 568-602 aa of BC035966 Sequence: QTIFQLGTFPDWADMYSVNVTALPPTLANDTFRTL Predict reactive species Full Name: solute carrier family 13 (sodium-dependent dicarboxylate transporter), member 3 Calculated Molecular Weight: 602 aa, 67 kDa Observed Molecular Weight: 55-60 kDa GenBank Accession Number: BC035966 Gene Symbol: SLC13A3 Gene ID (NCBI): 64849 RRID: AB_2880414 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8WWT9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924