Proteintech, 26187-1-AP, DRP1 (N-terminal) Polyclonal antibody

Size: 20ul / 150ul The DRP1 (N-terminal) (26187-1-AP) by Proteintech is a Polyclonal antibody targeting DRP1 (N-terminal) in WB, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 26187-1-AP targets DRP1 (N-terminal) in WB, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, rat brain tissue Positive IP detected in: mouse brain tissue Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information DNM1L(Dynamin-1-like protein) , also known as dynamin-related protein 1 (DRP1), belongs to the dynamin family of large GTPases that mediate membrane remodeling during a variety of cellular processes. DNM1L has an important role in the division of growing mitochondria and peroxisomes and also mediates outer mitochondrial membrane fission in mammalian cells. DNM1L is ubiquitously expressed with abundant expression in skeletal muscle, heart, kidney and brain.Variable isoforms of DNM1L have been reported in a tissue-specific manner due to the alternative splicing. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag24249 Product name: Recombinant human DNM1L,DLP1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 69-142 aa of BC024590 Sequence: HVSQEDKRKTTGEENGVEAEEWGKFLHTKNKLYTDFDEIRQEIENETERISGNNKGVSPEPIHLKIFSPNVVNL Predict reactive species Full Name: dynamin 1-like Calculated Molecular Weight: 736 aa, 82 kDa Observed Molecular Weight: 70-78 kDa GenBank Accession Number: BC024590 Gene Symbol: DRP1 Gene ID (NCBI): 10059 RRID: AB_2880417 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O00429 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.