Proteintech, 26194-1-AP, RPS6KB2 Polyclonal antibody

Size: 20ul / 150ul The RPS6KB2 (26194-1-AP) by Proteintech is a Polyclonal antibody targeting RPS6KB2 in WB, ELISA applications with reactivity to human samples 26194-1-AP targets RPS6KB2 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag23800 Product name: Recombinant human RPS6KB2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-51 aa of BC000094 Sequence: MAAVFDLDLETEEGSEGEGEPELSPADACPLAELRAAGLEPVGHYEEVELT Predict reactive species Full Name: ribosomal protein S6 kinase, 70kDa, polypeptide 2 Calculated Molecular Weight: 53 kDa Observed Molecular Weight: 54 kDa GenBank Accession Number: BC000094 Gene Symbol: RPS6KB2 Gene ID (NCBI): 6199 RRID: AB_2880419 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9UBS0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.