Proteintech, 26195-1-AP, Gamma Tubulin Polyclonal antibody

Size: 20ul / 150ul The Gamma Tubulin (26195-1-AP) by Proteintech is a Polyclonal antibody targeting Gamma Tubulin in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, canine samples 26195-1-AP targets Gamma Tubulin in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, canine samples. Tested Applications Positive WB detected in: mouse brain tissue, HeLa cells Positive IHC detected in: human skin cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: C2C12 cells, MDCK cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:250-1:1000 Background Information Gamma tubulin is a member of tubulin superfamily and is a key component required for microtubule nucleation and stabilization. It is concentrated at the pericentriolar material of centrosomes in interphase cells, predominantly on spindle poles in mitotic cells, while found in midbodies during cytokinesis. Overexpression of gamma tubulin has been found in various cancers including breast cancer and gliomas. This antibody can well label the centrosome structure. Specification Tested Reactivity: human, mouse, canine Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag23575 Product name: Recombinant human tubulin-gamma protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 150-451 aa of BC000619 Sequence: GSYLLERLNDRYPKKLVQTYSVFPNQDEMSDVVVQPYNSLLTLKRLTQNADCVVVLDNTALNRIATDRLHIQNPSFSQINQLVSTIMSASTTTLRYPGYMNNDLIGLIASLIPTPRLHFLMTGYTPLTTDQSVASVRKTTVLDVMRRLLQPKNVMVSTGRDRQTNHCYIAILNIIQGEVDPTQVHKSLQRIRERKLANFIPWGPASIQVALSRKSPYLPSAHRVSGLMMANHTSISSLFERTCRQYDKLRKREAFLEQFRKEDMFKDNFDEMDTSREIVQQLIDEYHAATRPDYISWGTQEQ Predict reactive species Full Name: tubulin, gamma 1 Calculated Molecular Weight: 51 kDa Observed Molecular Weight: 50-55 kDa GenBank Accession Number: BC000619 Gene Symbol: Gamma Tubulin Gene ID (NCBI): 7283 RRID: AB_2880420 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P23258 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.