Iright
BRAND / VENDOR: Proteintech

Proteintech, 26206-1-AP, SOCS2 Polyclonal antibody

CATALOG NUMBER: 26206-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The SOCS2 (26206-1-AP) by Proteintech is a Polyclonal antibody targeting SOCS2 in WB, ELISA applications with reactivity to human, rat samples 26206-1-AP targets SOCS2 in WB, ELISA applications and shows reactivity with human, rat samples. Tested Applications Positive WB detected in: K-562 cells, PC-12 cells Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Background Information SOCS2 is the substrate-recognition component of a cullin-5-RING E3 ubiquitin-protein ligase complex (ECS complex, also named CRL5 complex), which mediates the ubiquitination and subsequent proteasomal degradation of target proteins, such as EPOR and GHR (PMID: 11781573; 21980433; 25505247; 31182716; 34857742). Specification Tested Reactivity: human, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag24394 Product name: Recombinant human SOCS2 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 89-198 aa of BC010399 Sequence: SAGPTNLRIEYQDGKFRLDSIICVKSKLKQFDSVVHLIDYYVQMCKDKRTGPEAPRNGTVHLYLTKPLYTSAPSLQHLCRLTINKCTGAIWGLPLPTRLKDYLEEYKFQV Predict reactive species Full Name: suppressor of cytokine signaling 2 Calculated Molecular Weight: 198 aa, 22 kDa Observed Molecular Weight: 20-23 kDa GenBank Accession Number: BC010399 Gene Symbol: SOCS2 Gene ID (NCBI): 8835 RRID: AB_3669527 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O14508 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924