Proteintech, 26236-1-AP, PDZD11 Polyclonal antibody

Size: 20ul / 150ul The PDZD11 (26236-1-AP) by Proteintech is a Polyclonal antibody targeting PDZD11 in IHC, ELISA applications with reactivity to human, mouse samples 26236-1-AP targets PDZD11 in IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive IHC detected in: mouse kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information PDZ Domain Containing 11 (PDZD11), a small protein widely expressed in the body, is mainly comprised of a single PDZ domain. PDZD11 has often been reported to be associated with the adherens junction (AJ) of epithelial cells. PDZD11 binds nectins to the cadherin-and cytoskeleton-related protein complex by interacting with PLEKHA7 to stabilize the nexins at AJs and promotes efficient early assembly of junctions.(PMID: 38766598,PMID: 35714771) Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag23975 Product name: Recombinant human PDZD11 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 69-140 aa of BC012996 Sequence: QLGIFISKVIPDSDAHRAGLQEGDQVLAVNDVDFQDIEHSKAVEILKTAREISMRVRFFPYNYHRQKERTVH Predict reactive species Full Name: PDZ domain containing 11 GenBank Accession Number: BC012996 Gene Symbol: PDZD11 Gene ID (NCBI): 51248 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q5EBL8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.