Product Description
Size: 20ul / 150ul
The NT5DC3 (26242-1-AP) by Proteintech is a Polyclonal antibody targeting NT5DC3 in IP, ELISA applications with reactivity to human, mouse samples
26242-1-AP targets NT5DC3 in IP, ELISA applications and shows reactivity with human, mouse samples.
Tested Applications
Positive IP detected in: mouse testis tissue, HepG2 cells
Recommended dilution
Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Specification
Tested Reactivity: human, mouse
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag23962 Product name: Recombinant human NT5DC3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-98 aa of BC052293 Sequence: MTMAAAAVVARGAGARAATAAALRGGCGTAARGRPCAGPARPLCTAPGTAPDMKRYLWERYREAKRSTEELVPSIMSNLLNPDAIFSNNEMSLSDIEI Predict reactive species
Full Name: 5'-nucleotidase domain containing 3
Observed Molecular Weight: 63 kDa
GenBank Accession Number: BC052293
Gene Symbol: NT5DC3
Gene ID (NCBI): 51559
RRID: AB_2880442
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: Q86UY8
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924