Proteintech, 26268-1-AP, SPC24 Polyclonal antibody

Size: 20ul / 150ul The SPC24 (26268-1-AP) by Proteintech is a Polyclonal antibody targeting SPC24 in WB, ELISA applications with reactivity to human samples 26268-1-AP targets SPC24 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293T cells, Hela cells, HepG2 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag23256 Product name: Recombinant human SPC24 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-197 aa of BC105037 Sequence: MAAFRDIEEVSQGLLSLLGANRAEAQQRRLLGRHEQVVERLLETQDGAEKQLREILTMEKEVAQSLLNAKEQVHQGGVELQQLEAGLQEAGEEDTRLKASLLQLTRELEELKEIEADLERQEKEVDEDTTVTIPSAVYVAQLYHQVSKIEWDYECEPGMVKGIHHGPSVAQPIHLDSTQLSRKFISDYLWSLVDTEW Predict reactive species Full Name: SPC24, NDC80 kinetochore complex component, homolog (S. cerevisiae) Observed Molecular Weight: 26 kDa GenBank Accession Number: BC105037 Gene Symbol: SPC24 Gene ID (NCBI): 147841 RRID: AB_2880453 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8NBT2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.