Iright
BRAND / VENDOR: Proteintech

Proteintech, 26272-1-AP, FGF-21 Polyclonal antibody

CATALOG NUMBER: 26272-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The FGF-21 (26272-1-AP) by Proteintech is a Polyclonal antibody targeting FGF-21 in IHC, IF-P, ELISA applications with reactivity to human, mouse samples 26272-1-AP targets FGF-21 in IHC, IF-P, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive IHC detected in: human lung cancer tissue, human colon tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse liver tissue Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Background Information Fibroblast growth factor 21 (FGF21), a member of the FGF superfamily, has emerged as an important metabolic regulator. FGF21 is produced in the liver, adipocytes and skeletal muscle and regulates glucose, energy and lipid metabolism. FGF21 is a stress-responsive hepatokine which is induced in the liver as a response to injury, regeneration, hepatocarcinogenesis and during kidney dysfunction. FGF21 is primarily metabolized in the kidney and renal secretion is the major route of FGF21 elimination. Its plasma levels increase according to the decline in renal function in patients with chronic and acute renal dysfunction. Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag24064 Product name: Recombinant human FGF21 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 60-209 aa of BC018404 Sequence: HLEIREDGTVGGAADQSPESLLQLKALKPGVIQILGVKTSRFLCQRPDGALYGSLHFDPEACSFRELLLEDGYNVYQSEAHGLPLHLPGNKSPHRDPAPRGPARFLPLPGLPPAPPEPPGILAPQPPDVGSSDPLSMVGPSQGRSPSYAS Predict reactive species Full Name: fibroblast growth factor 21 Calculated Molecular Weight: 22 kDa GenBank Accession Number: BC018404 Gene Symbol: FGF21 Gene ID (NCBI): 26291 RRID: AB_2880455 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9NSA1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924