Iright
BRAND / VENDOR: Proteintech

Proteintech, 26277-1-AP, PDE7A Polyclonal antibody

CATALOG NUMBER: 26277-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The PDE7A (26277-1-AP) by Proteintech is a Polyclonal antibody targeting PDE7A in WB, ELISA applications with reactivity to human samples 26277-1-AP targets PDE7A in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Jurkat cells, K-562 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Specification Tested Reactivity: human Cited Reactivity: rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag24334 Product name: Recombinant human PDE7A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-55 aa of BC126360 Sequence: MGITLIWCLALVLIKWITSKRRGAISYDSSDQTALYIRMLGDVRVRSRAGFESER Predict reactive species Full Name: phosphodiesterase 7A Calculated Molecular Weight: 482 aa, 56 kDa Observed Molecular Weight: 48 kDa GenBank Accession Number: BC126360 Gene Symbol: PDE7A Gene ID (NCBI): 5150 RRID: AB_2880458 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q13946 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924