Proteintech, 26280-1-AP, L3MBTL4 Polyclonal antibody

Size: 20ul / 150ul The L3MBTL4 (26280-1-AP) by Proteintech is a Polyclonal antibody targeting L3MBTL4 in WB, IHC, ELISA applications with reactivity to human, mouse samples 26280-1-AP targets L3MBTL4 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse testis tissue Positive IHC detected in: human stomach tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag23588 Product name: Recombinant human L3MBTL4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-91 aa of BC039316 Sequence: MKQPNRKRKLNMDSKERLDQDGRLEQAEEEKKPKDSTTPLSHVPSAAAQGAWSWEWYLKEQKAVAAPVELFSKDQSFPEHENGFQIGMRLE Predict reactive species Full Name: l(3)mbt-like 4 (Drosophila) Observed Molecular Weight: 75-80 kDa GenBank Accession Number: BC039316 Gene Symbol: L3MBTL4 Gene ID (NCBI): 91133 RRID: AB_2880461 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8NA19 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.