Iright
BRAND / VENDOR: Proteintech

Proteintech, 26302-1-AP, ZNF641 Polyclonal antibody

CATALOG NUMBER: 26302-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The ZNF641 (26302-1-AP) by Proteintech is a Polyclonal antibody targeting ZNF641 in WB, IF/ICC, ELISA applications with reactivity to human, mouse , rat samples 26302-1-AP targets ZNF641 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse , rat samples. Tested Applications Positive WB detected in: mouse skeletal muscle tissue Positive IF/ICC detected in: A431 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information Zinc finger protein 641(ZNF 641) encodes a zinc-finger protein with five different C2H2 type zinc fingers and a KRAB-A box. Northern blot analysis indicates that ZNF641 is expressed in most of the examined adult tissues, at a high level in skeletal muscle. The ZNF 641 protein contains 438 amino acids and has 4 isoforms (50,43,47,48 kDa) produced by alternative splicing. Specification Tested Reactivity: human, mouse , rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag23672 Product name: Recombinant human ZNF641 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-118 aa of BC018090 Sequence: MLSEQTAALGTRWESMNVQLDGAEPQVERGSQEERPWRTVPGPLEHLCCDLEEEPQSLQEKAQSAPWVPAIPQEGNTGDWEMAAALLAAGSQGLVTIKDVSLCFSQEEWRSLDPSQTD Predict reactive species Full Name: zinc finger protein 641 Observed Molecular Weight: 40-45 kDa, 50-55 kDa GenBank Accession Number: BC018090 Gene Symbol: ZNF641 Gene ID (NCBI): 121274 RRID: AB_3085853 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96N77 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924