Product Description
Size: 20ul / 150ul
The RFX2 (26313-1-AP) by Proteintech is a Polyclonal antibody targeting RFX2 in IP, ELISA applications with reactivity to mouse samples
26313-1-AP targets RFX2 in IP, ELISA applications and shows reactivity with mouse samples.
Tested Applications
Positive IP detected in: mouse testis tissue
Recommended dilution
Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Specification
Tested Reactivity: mouse
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag24737 Product name: Recombinant human RFX2 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 336-450 aa of BC028579 Sequence: QYIDVSHVFPEFPAPDLGSFLLQDGVTLHDVKALQLVYRRHCEATVDVVMNLQFHYIEKLWLSFWNSKASSSDGPTSLPASDEDPEGAVLPKDKLISLCQCDPILRWMRSCDHIL Predict reactive species
Full Name: regulatory factor X, 2 (influences HLA class II expression)
Calculated Molecular Weight: 723 aa, 80 kDa
Observed Molecular Weight: 80 kDa
GenBank Accession Number: BC028579
Gene Symbol: RFX2
Gene ID (NCBI): 5990
RRID: AB_3085855
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: P48378
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924