Proteintech, 26340-1-AP, GTSF1 Polyclonal antibody

Size: 20ul / 150ul The GTSF1 (26340-1-AP) by Proteintech is a Polyclonal antibody targeting GTSF1 in WB, ELISA applications with reactivity to human, mouse, rat samples 26340-1-AP targets GTSF1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: K-562 cells, mouse testis tissue, rat testis tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag23647 Product name: Recombinant human GTSF1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-167 aa of BC021179 Sequence: MEETYTDSLDPEKLLQCPYDKNHQIRACRFPYHLIKCRKNHPDVASKLATCPFNARHQVPRAEISHHISSCDDRSCIEQDVVNQTRSLRQETLAESTWQCPPCDEDWDKDLWEQTSTPFAWGTTHYSDNNSPASNIVTEHKNNLASGMRVPKSLPYVLPWKNNGNAQ Predict reactive species Full Name: gametocyte specific factor 1 Observed Molecular Weight: 19-23 kDa GenBank Accession Number: BC021179 Gene Symbol: GTSF1 Gene ID (NCBI): 121355 RRID: AB_3085860 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8WW33 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.