Iright
BRAND / VENDOR: Proteintech

Proteintech, 26362-1-AP, POU5F2 Polyclonal antibody

CATALOG NUMBER: 26362-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The POU5F2 (26362-1-AP) by Proteintech is a Polyclonal antibody targeting POU5F2 in WB, ELISA applications with reactivity to human samples 26362-1-AP targets POU5F2 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: NCCIT cell Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Background Information POU5F2, also named as POU domain, class 5, transcription factor 2m, is a 328 amino acid protein, which contains 1 homeobox DNA-binding domain and 1 POU-specific domain and belongs to the POU transcription factor family. POU5F2 as a transcription factor, localizes in the nuclues and may exert a regulatory function in meiotic events that are required for terminal differentiation of male germ cell. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag23803 Product name: Recombinant human POU5F2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-144 aa of BC029532 Sequence: MDGHRPSNHFCPLPGSGGGGPRGPMPLRVDTLTWLSTQAAPGRVMVWPAVRPGICPGPDVWRIPLGPLPHEFRGWIAPCRPRLGASEAGDWLRRPSEGALPGPYIALRSIPKLPPPEDISGILKELQQLAKELRQKRLSLGYSQ Predict reactive species Full Name: POU domain class 5, transcription factor 2 Observed Molecular Weight: 42-45 kDa GenBank Accession Number: BC029532 Gene Symbol: POU5F2 Gene ID (NCBI): 134187 RRID: AB_2880491 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8N7G0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924