Iright
BRAND / VENDOR: Proteintech

Proteintech, 26379-1-AP, SLC25A36 Polyclonal antibody

CATALOG NUMBER: 26379-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The SLC25A36 (26379-1-AP) by Proteintech is a Polyclonal antibody targeting SLC25A36 in WB, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 26379-1-AP targets SLC25A36 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, rat brain tissue Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information SLC25A36 is a pyrimidine nucleotide carrier that belongs to the solute carrier family 25 (SLC25). SLC25A36 transports cytosine and uracil (deoxy)nucleosides monophosphate, diphosphate, and triphosphate via uniporter and antiporter(PMID: 25320081). It plays an important role in maintaining mitochondrial biogenesis. Loss of SLC25A36 in mouse embryonic stem cells (mESCs) is associated with mtDNA loss and mitochondrial dysfunction(PMID: 31036718). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag23894 Product name: Recombinant human SLC25A36 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 97-184 aa of BC014064 Sequence: IYFAAYSNCKEKLNDVFDPDSTQVHMISAAMAGFTAITATNPIWLIKTRLQLDARNRGERRMGAFECVRKVYQTDGLKGFYRGMSASY Predict reactive species Full Name: solute carrier family 25, member 36 Observed Molecular Weight: 32-34 kDa GenBank Accession Number: BC014064 Gene Symbol: SLC25A36 Gene ID (NCBI): 55186 RRID: AB_3669532 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96CQ1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924