Product Description
Size: 20ul / 150ul
The SLCO4A1 (26399-1-AP) by Proteintech is a Polyclonal antibody targeting SLCO4A1 in WB, ELISA applications with reactivity to human samples
26399-1-AP targets SLCO4A1 in WB, ELISA applications and shows reactivity with human samples.
Tested Applications
Positive WB detected in: A549 cells, HeLa cells, U-87 MG cells
Recommended dilution
Western Blot (WB): WB : 1:500-1:1000
Background Information
SLCO4A (Solute carrier organic anion transporter family member 4A1), also referred to as OATP4A1, is a membrane transporter protein, primarily facilitates the transmembrane transport of substances that are independent of Na+, including lipid‑soluble drugs, thyroid and adrenal hormones, and a selected few toxin (PMID: 38275113). SLCO4A1 is highly expressed in several cancers and promotes cell proliferation, migration and invasion (PMID: 28378090). Besides, SLCO4A1 was highly expressed in pancreatic cancer and could be a potential biomarker to target anticancer drugs to pancreatic carcinoma (PMID: 34924768).
Specification
Tested Reactivity: human
Cited Reactivity: human
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag23905 Product name: Recombinant human SLCO4A1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-103 aa of BC015727 Sequence: MPLHQLGDKPLTFPSPNSAMENGLDHTPPSRRASPGTPLSPGSLRSAAHSPLDTSKQPLCQLWAEKHGARGTHEVRYISAGQSVACGWWAFAPPCLQVLNTPK Predict reactive species
Full Name: solute carrier organic anion transporter family, member 4A1
Calculated Molecular Weight: 77 kDa
Observed Molecular Weight: 77 kDa
GenBank Accession Number: BC015727
Gene Symbol: SLCO4A1
Gene ID (NCBI): 28231
RRID: AB_2880501
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: Q96BD0
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924