Proteintech, 26406-1-AP, WISP3 Polyclonal antibody

Size: 20ul / 150ul The WISP3 (26406-1-AP) by Proteintech is a Polyclonal antibody targeting WISP3 in WB, IHC, IF/ICC, ELISA applications with reactivity to human samples 26406-1-AP targets WISP3 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Caco-2 cells, COLO 320 cells, HeLa cells, HepG2 cells Positive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information WISP3, also known as CCN6. Localized to the Mitochondria, and It is reported that CCN6 is located in the nucleus of breast cancer (PMID: 21262769). It is mainly expressed in adult kidney, testis and fetal kidney, and weakly expressed in placenta, ovary, prostate and small intestine (PMID: 9843955, PMID: 10471507). This gene is overexpressed in colon tumors, and it may be located downstream of WNT1 signaling pathway related to malignant transformation. Mutations of this gene are associated with progressive pseudorheumatoid dysplasia, an autosomal recessive skeletal disorder, indicating that the gene is essential for normal postnatal skeletal growth and cartilage homeostasis. Also it plays an important role in mitochondrial electron transfer and mitochondrial respiration, and may be important in bone growth and cartilage homeostasis after normal birth through its regulation of mitochondrial function (PMID: 27252383, PMID: 10471507). The calculated molecular weight of WISP3 is 39 kDa, and this antibody can recognize the 41 kDa isoform of WISP3. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag23999 Product name: Recombinant human WISP3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 231-295 aa of BC105941 Sequence: ATKWTPCSRTCGMGISNRVTNENSNCEMRKEKRLCYIQPCDSNILKTIKIPKGKTCQPTFQLSKA Predict reactive species Full Name: WNT1 inducible signaling pathway protein 3 Observed Molecular Weight: 39-42 kDa GenBank Accession Number: BC105941 Gene Symbol: WISP3 Gene ID (NCBI): 8838 RRID: AB_3085867 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O95389 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.