Proteintech, 26408-1-AP, HTR2B Polyclonal antibody

Size: 20ul / 150ul The HTR2B (26408-1-AP) by Proteintech is a Polyclonal antibody targeting HTR2B in WB, IHC, ELISA applications with reactivity to human, mouse samples 26408-1-AP targets HTR2B in WB, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse brain tissue Positive IHC detected in: human brain tissue, human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information The serotonin (5-HT) gene has been implicated in the development of personality traits or temperament predisposition. HTR2B(serotonin receptor 2B) has been shown that 3,4-methylene-dioxymethamphetamine, commonly referred to as the drug ecstasy, selectively binds and activates 5-HT2B receptors to induce serotonin release in mouse raphe nuclei, which leads to dopamine release in the nucleus accumbens and ventral tegmentum (PMID:23774082). Moreover, One of the most reliable predictive markers of UM (Uveal melanoma) at risk of evolving toward the formation of liver lesions is an abnormally elevated level of expression of the transcript encoding the HTR2B (PMID:31002821). Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag24007 Product name: Recombinant human HTR2B protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-56 aa of BC063123 Sequence: MALSYRVSELQSTIPEHILQSTFVHVISSNWSGLQTESIPEEMKQIVEEQGNKLHW Predict reactive species Full Name: 5-hydroxytryptamine (serotonin) receptor 2B Calculated Molecular Weight: 54 kDa Observed Molecular Weight: 54 kDa GenBank Accession Number: BC063123 Gene Symbol: HTR2B Gene ID (NCBI): 3357 RRID: AB_2880503 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P41595 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.