Proteintech, 26409-1-AP, FOPNL Polyclonal antibody

Size: 20ul / 150ul The FOPNL (26409-1-AP) by Proteintech is a Polyclonal antibody targeting FOPNL in WB, ELISA applications with reactivity to human samples 26409-1-AP targets FOPNL in WB, IHC, IF, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Specification Tested Reactivity: human Cited Reactivity: zebrafish Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag23991 Product name: Recombinant human C16orf63 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 30-174 aa of BC022321 Sequence: AEVFNALDDDREPRPSLSHENLLINELIREYLEFNKYKYTASVLIAESGQPVVPLDRQFLIHELNAFEESKDNTIPLLYGILAHFLRGTKDGIQNAFLKGPSLQPSDPSLGRQPSRRKPMDDHLRKEEQKSTNIEDLHVSQAVNR Predict reactive species Full Name: chromosome 16 open reading frame 63 Observed Molecular Weight: 22 kDa GenBank Accession Number: BC022321 Gene Symbol: FOPNL/CEP20 Gene ID (NCBI): 123811 RRID: AB_2880504 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96NB1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.