Iright
BRAND / VENDOR: Proteintech

Proteintech, 26424-1-AP, LHCGR Polyclonal antibody

CATALOG NUMBER: 26424-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The LHCGR (26424-1-AP) by Proteintech is a Polyclonal antibody targeting LHCGR in WB, IHC, IF-P, ELISA applications with reactivity to human, mouse samples 26424-1-AP targets LHCGR in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse ovary tissue Positive IHC detected in: human ovary cancer tissue, human ovary tissue, human thyroid cancer tissue, mouse ovary tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse ovary tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:100-1:4000 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Background Information LHCGR, also known as LHR or LSHR, belongs to the rhodopsin-like family of G protein-coupled receptors (GPCRs) and plays a crucial role in the regulation of gonadal functions by stimulating steroidogenesis in response to luteinizing hormone (LH) or hCG (PMID: 15866423). Mutations in LHCGR gene result in familial male-limited precocious puberty, Leydig cell hypoplasia, and empty follicle syndrome (PMID: 30711030). LHCGR protein consists of 699 amino acids with a calculated molecular weight of 79 kDa. Due to massive glycosylation, the molecular mass of the mature LHCGR is higher (85-100 kDa) than the predicted molecular protein mass of 79 kDa (PMID: 23686864; 15866423; 29075189; 15969756). Specification Tested Reactivity: human, mouse Cited Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag19259 Product name: Recombinant human LHCGR protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 49-219 aa of BC157028 Sequence: AGLTRLSLAYLPVKVIPSQAFRGLNEVIKIEISQIDSLERIEANAFDNLLNLSEILIQNTKNLRYIEPGAFINLPRLKYLSICNTGIRKFPDVTKVFSSESNFILEICDNLHITTIPGNAFQGMNNESVTLKLYGNGFEEVQSHAFNGTTLTSLELKENVHLEKMHNGAFR Predict reactive species Full Name: LHCGR Calculated Molecular Weight: 699 aa, 79 kDa Observed Molecular Weight: 100 kDa GenBank Accession Number: BC157028 Gene Symbol: LHCGR Gene ID (NCBI): 3973 RRID: AB_2880511 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P22888 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924