Iright
BRAND / VENDOR: Proteintech

Proteintech, 26431-1-AP, C19orf40 Polyclonal antibody

CATALOG NUMBER: 26431-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The C19orf40 (26431-1-AP) by Proteintech is a Polyclonal antibody targeting C19orf40 in WB, IF/ICC, ELISA applications with reactivity to human samples 26431-1-AP targets C19orf40 in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A431 cells, A549 cells, K-562 cells, THP-1 cells Positive IF/ICC detected in: A549 cells Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag23940 Product name: Recombinant human C19orf40 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-215 aa of BC003535 Sequence: MEKNPPDDTGPVHVPLGHIVANEKWRGSQLAQEMQGKIKLIFEDGLTPDFYLSNRCCILYVTEADLVAGNGYRKRLVRVRNSNNLKGIVVVEKTRMSEQYFPALQKFTVLDLGMVLLPVASQMEASCLVIQLVQEQTKEPSKNPLLGKKRALLLSEPSLLRTVQQIPGVGKVKAPLLLQKFPSIQQLSNASIGELEQVVGQAVAQQIHAFFTQPR Predict reactive species Full Name: chromosome 19 open reading frame 40 Observed Molecular Weight: 24-27 kDa GenBank Accession Number: BC003535 Gene Symbol: C19orf40 Gene ID (NCBI): 91442 RRID: AB_3085870 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9BTP7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924