Product Description
Size: 20ul / 150ul
The 5HT2A Receptor (26438-1-AP) by Proteintech is a Polyclonal antibody targeting 5HT2A Receptor in IHC, ELISA applications with reactivity to human samples
26438-1-AP targets 5HT2A Receptor in IHC, IF, ELISA applications and shows reactivity with human samples.
Tested Applications
Positive IHC detected in: human brain tissue, human small intestine tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0
Recommended dilution
Immunohistochemistry (IHC): IHC : 1:50-1:500
Background Information
The 5HT2A Receptor gene (HTR2A) codes for a G-protein coupled receptor and belongs to the G-protein coupled receptor 1 family. HTR2A plays a key role in serotonin pathway regulation. HTR2A affects neural activity, perception, cognition, and mood and functions as the main target of atypical antipsychotic drugs (PMID: 17691947, 21550210). 5HT2A Receptor has 2 isoforms with the molecular mass of 44 and 53 kDa.
Specification
Tested Reactivity: human
Cited Reactivity: mouse
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag24056 Product name: Recombinant human HTR2A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 387-471 aa of BC074848 Sequence: YRSAFSRYIQCQYKENKKPLQLILVNTIPALAYKSSQLQMGQKKNSKQDAKTTDNDCSMVALGKQHSEEASKDNSDGVNEKVSCV Predict reactive species
Full Name: 5-hydroxytryptamine (serotonin) receptor 2A
Calculated Molecular Weight: 471 aa, 53 kDa
GenBank Accession Number: BC074848
Gene Symbol: 5HT2A Receptor
Gene ID (NCBI): 3356
RRID: AB_3085872
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: P28223
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924