Iright
BRAND / VENDOR: Proteintech

Proteintech, 26441-1-AP, PET112L Polyclonal antibody

CATALOG NUMBER: 26441-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The PET112L (26441-1-AP) by Proteintech is a Polyclonal antibody targeting PET112L in WB, ELISA applications with reactivity to human, mouse samples 26441-1-AP targets PET112L in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: Jurkat cells, mouse heart tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Background Information GATB (Glutamyl-tRNA(Gln) amidotransferase subunit B), also called PET112L, is a subunit of the glutamyl-tRNA(Gln) amidotransferase protein complex (GatCAB), which plays a role in the proper aminoacylation of mitochondrial glutaminyl mt-tRNA (mt-tRNA(Gln)). The other 2 subunits in the enzyme complex are GATA and GATC. The complex plays an essential role in mitochondrial translation and protein synthesis (PMID: 30283131, 19805282). Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag23740 Product name: Recombinant human PET112L protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 204-557 aa of BC136547 Sequence: SQTLIDLNRAGVGLLEVVLEPDMSCGEEAATAVRELQLILQALGTSQANMAEGQLRVDANISVHHPGEPLGVRTEVKNLNSIRFLAKAIDYEIQRQINELENGGEILNETRSFHHKLGCTMSMRDKEGKQDYRFMPEPNLPPLVLYDATSLPAGADPQQVINIDQIRETLPELPSVTREKLVQQYGMLLEHSFTLLNEVGLLEFFQNVIKETRAEPKKVTSWVLNTFLGYLKQQNLAVSESPVTPSALAELLDLLDSRTISSSAAKQVFEELWKREGKTPGQIVSEKQLELMQDQGALEQLCHSVMEAHPQVVMDVKNRNPRAINKLIGLVRKATQSRADPVMIKEILEKKLSL Predict reactive species Full Name: PET112-like (yeast) Observed Molecular Weight: 55-62 kDa GenBank Accession Number: BC136547 Gene Symbol: PET112L Gene ID (NCBI): 5188 RRID: AB_3669534 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O75879 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924