Iright
BRAND / VENDOR: Proteintech

Proteintech, 26442-1-AP, ZCCHC12 Polyclonal antibody

CATALOG NUMBER: 26442-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The ZCCHC12 (26442-1-AP) by Proteintech is a Polyclonal antibody targeting ZCCHC12 in WB, ELISA applications with reactivity to human, mouse, rat samples 26442-1-AP targets ZCCHC12 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, rat brain tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Background Information Zinc finger CCHC domain-containing protein 12 (ZCCHC12) functions as a transcriptional coactivator in the bone morphogenetic protein (BMP)-signaling pathway (PMID: 19578717; 19416967). It positively modulates BMP signaling by interacting with SMAD1 and associating with CBP in the transcription complex (PMID: 18160706). It contributes to the BMP-induced enhancement of cholinergic-neuron-specific gene expression. A variant in ZCCHC12 may play a role in X-linked cognitive disability (PMID: 18798319). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag23858 Product name: Recombinant human ZCCHC12 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 154-402 aa of BC031241 Sequence: VQLQNAIQAGIIAEKDANRTRLQQLLLGGELSRDLRLRLKDFLRMYANEQERLPNFLELIRMVREEEDWDDAFIKRKRPKRSESMVERAVSPVAFQGSPPIVIGSADCNVIEIDDTLDDSDEDVILVESQDPPLPSWGAPPLRDRARPQDEVLVIDSPHNSRAQFPSTSGGSGYKNNGPGEMRRARKRKHTIRCSYCGEEGHSKETCDNESDKAQVFENLIITLQELTHTEMERSRVAPGEYNDFSEPL Predict reactive species Full Name: zinc finger, CCHC domain containing 12 Observed Molecular Weight: 35-40 kDa GenBank Accession Number: BC031241 Gene Symbol: ZCCHC12 Gene ID (NCBI): 170261 RRID: AB_3085873 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q6PEW1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924