Proteintech, 26444-1-AP, TMEM97 Polyclonal antibody

Size: 20ul / 150ul The TMEM97 (26444-1-AP) by Proteintech is a Polyclonal antibody targeting TMEM97 in WB, IHC, ELISA applications with reactivity to human, mouse samples 26444-1-AP targets TMEM97 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: Caco-2 cells, HEK-293T cells, HeLa cells, mouse testis tissue Positive IHC detected in: mouse testis tissue, human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag23917 Product name: Recombinant human TMEM97 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-69 aa of BC045655 Sequence: MTTLIPILSTFLFEDFSKASGFKGQRPETLHERLTLVSVYAPYLLIPFILLIFMLRSPYYKYEEKRKKK Predict reactive species Full Name: transmembrane protein 97 Observed Molecular Weight: 19-20 kDa GenBank Accession Number: BC045655 Gene Symbol: TMEM97 Gene ID (NCBI): 27346 RRID: AB_2880515 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q5BJF2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.