Proteintech, 26447-1-AP, SRMS Polyclonal antibody

Size: 20ul / 150ul The SRMS (26447-1-AP) by Proteintech is a Polyclonal antibody targeting SRMS in IP, IHC, ELISA applications with reactivity to human samples 26447-1-AP targets SRMS in IP, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive IP detected in: HL-60 cells Positive IHC detected in: human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:100-1:400 Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag24062 Product name: Recombinant human SRMS protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 418-488 aa of BC153198 Sequence: EVFTYGQCPYEGMTNHETLQQIMRGYRLPRPAACPAEVYVLMLECWRSSPEERPSFATLREKLHAIHRCHP Predict reactive species Full Name: src-related kinase lacking C-terminal regulatory tyrosine and N-terminal myristylation sites Calculated Molecular Weight: 488 aa, 55 kDa Observed Molecular Weight: 55 kDa GenBank Accession Number: BC153198 Gene Symbol: SRMS Gene ID (NCBI): 6725 RRID: AB_2880516 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9H3Y6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.