Iright
BRAND / VENDOR: Proteintech

Proteintech, 26449-1-AP, NME7 Polyclonal antibody

CATALOG NUMBER: 26449-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The NME7 (26449-1-AP) by Proteintech is a Polyclonal antibody targeting NME7 in WB, IHC, ELISA applications with reactivity to human, mouse samples 26449-1-AP targets NME7 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse embryo tissue Positive IHC detected in: human brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information NME7, also named as NDK7, nm23-H7, plays the major role in the synthesis of nucleoside triphosphates other than ATP. NME7 has two isoforms with MW 38-42 kDa. Specification Tested Reactivity: human, mouse Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag24918 Product name: Recombinant human NME7 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-90 aa of BC006983 Sequence: MNHSERFVFIAEWYDPNASLLRRYELLFYPGDGSVEMHDVKNHRTFLKRTKYDNLHLEDLFIGNKVNVFSRQLVLIDYGDQYTARQLGSR Predict reactive species Full Name: non-metastatic cells 7, protein expressed in (nucleoside-diphosphate kinase) Calculated Molecular Weight: 376 aa, 42 kDa Observed Molecular Weight: 38-42 kDa GenBank Accession Number: BC006983 Gene Symbol: NME7 Gene ID (NCBI): 29922 RRID: AB_2880517 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9Y5B8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924