Product Description
Size: 20ul / 150ul
The TMEM160 (26451-1-AP) by Proteintech is a Polyclonal antibody targeting TMEM160 in WB, IHC, ELISA applications with reactivity to human samples
26451-1-AP targets TMEM160 in WB, IHC, ELISA applications and shows reactivity with human samples.
Tested Applications
Positive WB detected in: HEK-293 cells
Positive IHC detected in: human intrahepatic cholangiocarcinoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0
Recommended dilution
Western Blot (WB): WB : 1:500-1:1000
Immunohistochemistry (IHC): IHC : 1:50-1:500
Background Information
The transmembrane protein (TMEM) family encompasses transmembrane proteins that traverse the lipid bilayer and wield critical functions across various cell types, encompassing inflammation and store-operated Ca2+ entry. TMEM160, a identified transmembrane protein that is localized in the mitochondrial membrane, has been implicated in neuropathic pain.
Specification
Tested Reactivity: human
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag24915 Product name: Recombinant human TMEM160 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-68 aa of BC002907 Sequence: MGGGWWWARAARLARLRFRRSLLPPQRPRSGGARGSFAPGHGPRAGASPPPVSELDRADAWLLRKAHE Predict reactive species
Full Name: transmembrane protein 160
Calculated Molecular Weight: 188 aa, 20 kDa
Observed Molecular Weight: 15-20 kDa
GenBank Accession Number: BC002907
Gene Symbol: TMEM160
Gene ID (NCBI): 54958
RRID: AB_3669535
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: Q9NX00
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924