Proteintech, 26456-1-AP, GMAP-210 Polyclonal antibody

Size: 20ul / 150ul The GMAP-210 (26456-1-AP) by Proteintech is a Polyclonal antibody targeting GMAP-210 in WB, IHC, IF/ICC, ELISA applications with reactivity to human samples 26456-1-AP targets GMAP-210 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, HL-60 cells Positive IHC detected in: human thyroid cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:250-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:300-1:1200 Background Information Golgi microtubule-associated protein 210 (GMAP-210), also referred to as CEV14, Trip11 or Trip230, is a peripheral Golgi protein that localizes to the cis-Golgi network. GMAP-210 is a 1,978 amino acid coiled-coil member of the golgin family of proteins. Microtubule ends bind to GMAP-210 which functions to link the cis-Golgi network to the minus ends of centrosome-nucleated microtubules. This interaction may be essential for the proper morphology and structural maintenance of the Golgi apparatus. GMAP-210 also associates with thyroid hormone receptor. Overexpression of GMAP-210 disrupts the micro-tubule network and causes a significant enlargement and fragmentation of the Golgi apparatus; it also blocks anterograde and retrograde transport between the ER and the Golgi apparatus. Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag13867 Product name: Recombinant human GMAP-210 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-68 aa of BC002656 Sequence: AMSSWLGGLGSGLGQSLGQVGGSLASLTGQISNFTKDMLMEGTEEVEAELPDSRTKEIEAIHAILRSE Predict reactive species Full Name: thyroid hormone receptor interactor 11 Calculated Molecular Weight: 1979 aa, 228 kDa Observed Molecular Weight: 230 kDa GenBank Accession Number: BC002656 Gene Symbol: TRIP11 Gene ID (NCBI): 9321 RRID: AB_2880519 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q15643 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.