Iright
BRAND / VENDOR: Proteintech

Proteintech, 26466-1-AP, GLE1 Polyclonal antibody

CATALOG NUMBER: 26466-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The GLE1 (26466-1-AP) by Proteintech is a Polyclonal antibody targeting GLE1 in WB, IF/ICC, ELISA applications with reactivity to human samples 26466-1-AP targets GLE1 in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, A549 cells, MCF-7 cells, PC-3 cells, HepG2 cells, Jurkat cells Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag24208 Product name: Recombinant human GLE1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-118 aa of BC030012 Sequence: MPSEGRCWETLKALRSSDKGRLCYYRDWLLRREDVLEECMSLPKLSSYSGWVVEHVLPHMQENQPLSETSPSSTSASALDQPSFVPKSPDASSAFSPASPATPNGTKGKDESQHTESM Predict reactive species Full Name: GLE1 RNA export mediator homolog (yeast) Calculated Molecular Weight: 80 kDa Observed Molecular Weight: 79-80 kDa GenBank Accession Number: BC030012 Gene Symbol: GLE1 Gene ID (NCBI): 2733 RRID: AB_2880525 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q53GS7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924