Proteintech, 26469-1-AP, Mitoferrin 1 Polyclonal antibody

Size: 20ul / 150ul The Mitoferrin 1 (26469-1-AP) by Proteintech is a Polyclonal antibody targeting Mitoferrin 1 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 26469-1-AP targets Mitoferrin 1 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: L02 cells, mouse liver tissue, mouse spleen tissue, rat spleen tissue Positive IHC detected in: human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag24876 Product name: Recombinant human SLC25A37 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-44 aa of BC132799 Sequence: MELRSGSVGSQAVARRMDGDSRDGGGGKDATGSEDYENLPTSAS Predict reactive species Full Name: solute carrier family 25, member 37 Observed Molecular Weight: 37 kDa GenBank Accession Number: BC132799 Gene Symbol: Mitoferrin 1 Gene ID (NCBI): 51312 RRID: AB_2880527 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9NYZ2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.