Proteintech, 26472-1-AP, TRMT112 Polyclonal antibody

Size: 20ul / 150ul The TRMT112 (26472-1-AP) by Proteintech is a Polyclonal antibody targeting TRMT112 in WB, IHC, ELISA applications with reactivity to human samples 26472-1-AP targets TRMT112 in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293 cells, HeLa cells, K-562 cells, PC-3 cells, SH-SY5Y cells Positive IHC detected in: human ovary tumor tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunohistochemistry (IHC): IHC : 1:250-1:1000 Background Information TRMT112 is a small evolutionarily conserved protein that acts as a co-factor and activator for different MTases involved in rRNA, tRNA and protein methylation. The TRMT112 interaction with 18S rRNA MTases WBSCR22 (BUD23, MERM1) and METTL5 is required for their metabolic stability and enzymatic activity in cells. (PMID: 34948388, PMID: 34948388) Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag24126 Product name: Recombinant human HSPC152 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 40-125 aa of BC017172 Sequence: NFVARMIPKVEWSAFLEAADNLRLIQVPKGPVEGYEENEEFLRTMHHLLLEVEVIEGTLQCPESGRMFPISRGIPNMLLSEEETES Predict reactive species Full Name: hypothetical protein HSPC152 Observed Molecular Weight: 14 kDa GenBank Accession Number: BC017172 Gene Symbol: TRMT112 Gene ID (NCBI): 51504 RRID: AB_3085875 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9UI30 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.