Iright
BRAND / VENDOR: Proteintech

Proteintech, 26503-1-AP, FCRL5 Polyclonal antibody

CATALOG NUMBER: 26503-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The FCRL5 (26503-1-AP) by Proteintech is a Polyclonal antibody targeting FCRL5 in WB, ELISA applications with reactivity to human samples 26503-1-AP targets FCRL5 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Daudi cells, Raji cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information FCRL5, also known as CD307 or IRTA2, is a surface protein expressed selectively on B cells and plasma cells (PMID: 11290337). This protein has both an immunoreceptor tyrosine-based activation motif (ITAM)-like sequence and two consensus immunoreceptor tyrosine-based inhibitory motifs (ITIM) in its cytoplasmic region (PMID: 17522256). FCRL5 is implicated in B cell development and lymphomagenesis (PMID: 11290337; 11453668). It may have an immunoregulatory role in marginal zone B-cells. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag24351 Product name: Recombinant human FCRL5 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 245-375 aa of BC101067 Sequence: FQITAMWSKDSGFYWCKAATMPYSVISDSPRSWIQVQIPASHPVLTLSPEKALNFEGTKVTLHCETQEDSLRTLYRFYHEGVPLRHKSVRCERGASISFSLTTENSGNYYCTADNGLGAKPSKAVSLSVTV Predict reactive species Full Name: Fc receptor-like 5 Calculated Molecular Weight: 977 aa, 106 kDa Observed Molecular Weight: 100 kDa GenBank Accession Number: BC101067 Gene Symbol: FCRL5 Gene ID (NCBI): 83416 RRID: AB_2880535 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96RD9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924