Product Description
Size: 20ul / 150ul
The BCAM (26528-1-AP) by Proteintech is a Polyclonal antibody targeting BCAM in WB, ELISA applications with reactivity to human samples
26528-1-AP targets BCAM in WB, IF, ELISA applications and shows reactivity with human samples.
Tested Applications
Positive WB detected in: A431 cells, HT-29 cells, human placenta tissue
Recommended dilution
Western Blot (WB): WB : 1:2000-1:16000
Background Information
Basal cell adhesion molecule (Lu/BCAM) is a membrane-bound glycoprotein of the immunoglobulin superfamily (IgSF), functioning as a receptor for the extracellular matrix protein, laminin. BCAM (Lutheran/basal cell-adhesion molecule, a glycoprotein) belongs to the immunoglobulin superfamily which contains both Lu blood group and BCAM tumor-associated antigens. Proteomics analysis suggests that BCAM might be a potential biomarker for pancreatic cancer (PMID: 19199705). BCAM, involved in cell adhesion and migration, can also promote tumor metastasis and has been elucidated to play a functional role in the metastasis of thyroid cancer and gastric cancer (PMID: 10728810, 35941663). De-glycosylated BCAM has a preidicted molecular weight of 67 kDa. Two BCAM glycoprotein (gp) isoforms are present on human RBCs, Lu (85 kDa) and Lu(v13) (78 kDa); they result from the alternative splicing of intron 13 and differ by the lengths of their cytoplasmic domains (PMID: 23160466).
Specification
Tested Reactivity: human
Cited Reactivity: mouse
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag24753 Product name: Recombinant human BCAM protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 569-628 aa of BC050450 Sequence: YCVRRKGGPCCRQRREKGAPPPGEPGLSHSGSEQPEQTGLLMGGASGGARGGSGGFGDEC Predict reactive species
Full Name: basal cell adhesion molecule (Lutheran blood group)
Calculated Molecular Weight: 67 kDa
Observed Molecular Weight: 67 kDa, 78-85 kDa
GenBank Accession Number: BC050450
Gene Symbol: BCAM
Gene ID (NCBI): 4059
RRID: AB_3669545
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: P50895
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924