Iright
BRAND / VENDOR: Proteintech

Proteintech, 26541-1-AP, XYLB Polyclonal antibody

CATALOG NUMBER: 26541-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The XYLB (26541-1-AP) by Proteintech is a Polyclonal antibody targeting XYLB in WB, IHC, ELISA applications with reactivity to human samples 26541-1-AP targets XYLB in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A431 cells Positive IHC detected in: human skin cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:100-1:400 Background Information Human xylulokinase-like protein (XYLB), is a 58 kDa protein belongs to a family of enzymes that include fucokinase, gluconokinase, glycerokinase and xylulokinase. XYLB is a key regulator for controlling metabolic disease.XYLB also plays important roles in energy metabolism. XYLB has 2 isoforms produced by alternative splicing with the MW of 58 and 43 kDa. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag19208 Product name: Recombinant human XYLB protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 185-536 aa of BC137076 Sequence: EAYSHTERISLVSSFAASLFLGSYSPIDYSDGSGMNLLQIQDKVWSQACLGACAPHLEEKLSPPVPSCSVVGAISSYYVQRYGFPPGCKVVAFTGDNPASLAGMRLEEGDIAVSLGTSDTLFLWLQEPMPALEGHIFCNPVDSQHYMALLCFKNGSLMREKIRNESVSRSWSDFSKALQSTEMGNGGNLGFYFDVMEITPEIIGRHRFNTENHKVAAFPGDVEVRALIEGQFMAKRIHAEGLGYRVMSKTKILATGGASHNREILQVLADVFDAPVYVIDTANSACVGSAYRAFHGLAGGTDVPFSEVVKLAPNPRLAATPSPGASQVYEALLPQYAKLEQRILSQTRGPPE Predict reactive species Full Name: xylulokinase homolog (H. influenzae) Calculated Molecular Weight: 536 aa, 58 kDa Observed Molecular Weight: 43 kDa GenBank Accession Number: BC137076 Gene Symbol: XYLB Gene ID (NCBI): 9942 RRID: AB_2880546 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O75191 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924