Proteintech, 26544-1-AP, MUC7 Polyclonal antibody

Size: 20ul / 150ul The MUC7 (26544-1-AP) by Proteintech is a Polyclonal antibody targeting MUC7 in WB, ELISA applications with reactivity to human samples 26544-1-AP targets MUC7 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: human saliva Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag24216 Product name: Recombinant human MUC7 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 22-95 aa of BC025688 Sequence: GRERDHELRHRRHHHQSPKSHFELPHYPGLLAHQKPFIRKSYKCLHKRCRPKLPPSPNNPPKFPNPHQPPKHPD Predict reactive species Full Name: mucin 7, secreted Calculated Molecular Weight: 39 kDa Observed Molecular Weight: 38-40 kDa GenBank Accession Number: BC025688 Gene Symbol: MUC7 Gene ID (NCBI): 4589 RRID: AB_3085880 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8TAX7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.