Iright
BRAND / VENDOR: Proteintech

Proteintech, 26545-1-AP, ZDHHC1 Polyclonal antibody

CATALOG NUMBER: 26545-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The ZDHHC1 (26545-1-AP) by Proteintech is a Polyclonal antibody targeting ZDHHC1 in WB, ELISA applications with reactivity to human samples 26545-1-AP targets ZDHHC1 in WB, IHC, CoIP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A549 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information Catalog#26545-1-AP recognises 48-55 kDa bands. Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag24028 Product name: Recombinant human ZDHHC1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 304-485 aa of BC021908 Sequence: KMRPIQEMEFYMRTFRHMRPEPPGQAGPAAVNAKHSRPASPDPTPGRRDCAGPPVQVEWDRKKPLPWRSPLLLLAMWGPQAPPCLCRKRGRGACIKCERLRPRIRRRGLGPPAAAPARRRIPRTPALCTPLALPAPTTRRRQSPWTRFQWRRRAWAAPLWPPRGAGADSPRWRGRRVRPPFS Predict reactive species Full Name: zinc finger, DHHC-type containing 1 Observed Molecular Weight: 48-55 kDa GenBank Accession Number: BC021908 Gene Symbol: ZDHHC1 Gene ID (NCBI): 29800 RRID: AB_2880547 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8WTX9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924