Iright
BRAND / VENDOR: Proteintech

Proteintech, 26547-1-AP, KLK4 Polyclonal antibody

CATALOG NUMBER: 26547-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The KLK4 (26547-1-AP) by Proteintech is a Polyclonal antibody targeting KLK4 in IP, IHC, ELISA applications with reactivity to human samples 26547-1-AP targets KLK4 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive IP detected in: DU 145 cells Positive IHC detected in: human prostate hyperplasia tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Specification Tested Reactivity: human Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag24240 Product name: Recombinant human KLK4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 67-114 aa of BC069325 Sequence: LSAAHCFQNSYTIGLGLHSLEADQEPGSQMVEASLSVRHPEYNRPLLA Predict reactive species Full Name: kallikrein-related peptidase 4 Calculated Molecular Weight: 254 aa, 27 kDa Observed Molecular Weight: 30 kDa GenBank Accession Number: BC069325 Gene Symbol: KLK4 Gene ID (NCBI): 9622 RRID: AB_2880548 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9Y5K2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924