Iright
BRAND / VENDOR: Proteintech

Proteintech, 26548-1-AP, SLC33A1 Polyclonal antibody

CATALOG NUMBER: 26548-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The SLC33A1 (26548-1-AP) by Proteintech is a Polyclonal antibody targeting SLC33A1 in WB, ELISA applications with reactivity to human, mouse samples 26548-1-AP targets SLC33A1 in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse brain tissue, mouse heart tissue Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information SLC33A1 mediates active acetyl-CoA import through the endoplasmic reticulum (ER) membrane into the ER lumen where specific ER-based acetyl-CoA:lysine acetyltransferases are responsible for the acetylation of ER-based protein substrates. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag24323 Product name: Recombinant human SLC33A1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-73 aa of BC014416 Sequence: MSPTISHKDSSRQRRPGNFSHSLDMKSGPLPPGGWDDSHLDSAGREGDREALLGDTGTGDFLKAPQSFRAELS Predict reactive species Full Name: solute carrier family 33 (acetyl-CoA transporter), member 1 Calculated Molecular Weight: 549 aa, 61 kDa Observed Molecular Weight: 60-62 kDa GenBank Accession Number: BC014416 Gene Symbol: SLC33A1 Gene ID (NCBI): 9197 RRID: AB_3085881 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O00400 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924