Proteintech, 26561-1-AP, LIMCH1 Polyclonal antibody

Size: 20ul / 150ul The LIMCH1 (26561-1-AP) by Proteintech is a Polyclonal antibody targeting LIMCH1 in WB, IHC, ELISA applications with reactivity to human samples 26561-1-AP targets LIMCH1 in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, mouse brain tissue Positive IHC detected in: human intrahepatic cholangiocarcinoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:2000-1:12000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Background Information LIM and calponin-homology domains 1 (LIMCH1) was identified from a border cell migration screen based on conditional ectopic expression in Drosophila. It's a kind of actin stress fibers-associated protein that activates non-muscle myosin IIa. Through the activation of non-muscle myosin IIa, LIMCH1 positively regulates actin stress fibers assembly and stabilizes focal adhesions, negatively regulates cell spreading and cell migration. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag24112 Product name: Recombinant human LIMCH1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 211-566 aa of BC023546 Sequence: RWKSRRRSVSQDLIKKEEERKKMEKLLAGEDGTSERRKSIKTYREIVQEKERRERELHEAYKNARSQEEAEGILQQYIERFTISEAVLERLEMPKILERSHSTEPNLSSFLNDPNPMKYLRQQSLPPPKFTATVETTIARASVLDTSMSAGSGSPSKTVTPKAVPMLTPKPYSQPKNSQDVLKTFKVDGKVSVNGETVHREEEKERECPTVAPAHSLTKSQMFEGVARVHGSPLELKQDNGSIEINIKKPNSVPQELAATTEKTEPNSQEDKNDGGKSRKGNIELASSEPQHFTTTVTRCSPTVAFVEFPSSPQLKNDVSEEKDQKKPENEMSGKVELVLSQKVVKPKSPEPEATL Predict reactive species Full Name: LIM and calponin homology domains 1 Observed Molecular Weight: ~150 kDa GenBank Accession Number: BC023546 Gene Symbol: LIMCH1 Gene ID (NCBI): 22998 RRID: AB_3085883 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9UPQ0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.