Proteintech, 26592-1-AP, Cardiac Troponin T Polyclonal antibody

Size: 20ul / 150ul The Cardiac Troponin T (26592-1-AP) by Proteintech is a Polyclonal antibody targeting Cardiac Troponin T in WB, IHC, IF-P, ELISA applications with reactivity to human, mouse, rat samples 26592-1-AP targets Cardiac Troponin T in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse heart tissue, rat heart tissue Positive IHC detected in: human heart tissue, mouse heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse heart tissue Recommended dilution Western Blot (WB): WB : 1:2000-1:12000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag24911 Product name: Recombinant human cTnT protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-76 aa of BC002653 Sequence: MSDIEEVVEEYEEEEQEEAAVEEQEEAAEEDAEAEAETEETRAEEDEEEEEAKEAEDGPMEESKPKPRSFMPNLVP Predict reactive species Full Name: troponin T type 2 (cardiac) Calculated Molecular Weight: 36 kDa Observed Molecular Weight: 34-40 kDa GenBank Accession Number: BC002653 Gene Symbol: Cardiac Troponin T Gene ID (NCBI): 7139 RRID: AB_2880566 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P45379 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.